HPA018124

ZNF71 antibody from Sigma-Aldrich
Cos26, EZFIT
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018124
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018124, RRID:AB_1848339
Product name
Anti-ZNF71 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018124
Antibody type
Polyclonal
Antigen
Endothelial zinc finger protein induced by tumor necrosis factor alpha recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DISEDKLSVVGEATGGPTRNGARGPGSEGVWEPGS
WPERPRGDAGAEWEPLGIPQGNKLLGGSVPACHEL
KAFANQGCVLVPPRLDDPTEKGACPPVRRGKNFSS
TSDLSKPPMPCEEKKTYDCSECGKAFSRSSSLIK
Storage
-20C
Provider Type Product Number
- No reagents -