HPA014314

PKP2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014314
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014314, RRID:AB_1855451
Product name
Anti-PKP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014314
Antibody type
Polyclonal
Antigen
Plakophilin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VGNGNLHRTSSVPEYVYNLHLVENDFVGGRSPVPK
TYDMLKAGTTATYEGRWGRGTAQYSSQKSVEERSL
RHPLRRLEISPDSSPERAHYTHSDYQYSQRSQAGH
TLHHQESRRAALLVPPRY
Storage
-20C
Provider Type Product Number
- No reagents -