HPA021064

USP29 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021064
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021064, RRID:AB_1858676
Product name
Anti-USP29 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021064
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 29 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VYIPKSLSLSSYCNESTKPPLPLSSSAPVGKCEVL
EVSQEMISEINSPLTPSMKLTSESSDSLVLPVEPD
KNADLQRFQRDCGDASQEQHQRDLENGSALESELV
HFRDRAIGEKELPVADSLMDQGDISLPVMYEDGGK
LISSPD
Storage
-20C
Provider Type Product Number
- No reagents -