AV38320

ZNF264 antibody from Sigma-Aldrich
KIAA0412
No application information provided.

Antibody data

Product number
AV38320
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV38320, RRID:AB_1859158
Product name
Anti-ZNF264 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV38320
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF264 with an internal ID of P23131
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGQTSVTLRELLLGKDFLNVTTEANILPEETSSSA
SDQPYQRETPQVSSL
Storage
-20C
Provider Type Product Number
- No reagents -