SAB2102839

ZNF264 antibody from Sigma-Aldrich
KIAA0412
No application information provided.

Antibody data

Product number
SAB2102839
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2102839, RRID:AB_10606487
Product name
Anti-ZNF264 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2102839
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_003408.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AAAVLTDRAQVSVTFDDVAVTFTKEEWGQLDLAQR
TLYQEVMLENCGLLV
Storage
-20C
Provider Type Product Number
- No reagents -