HPA014461

DHPS antibody from Sigma-Aldrich
MIG13
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014461
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014461, RRID:AB_1847651
Product name
Anti-DHPS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014461
Antibody type
Polyclonal
Antigen
Deoxyhypusine synthase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKELRENGINRIGNLLVPNENYCKFEDWLMPILDQ
MVMEQNTEGVKWTPSKMIARLGKEINNPESVYYWA
QKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDI
VE
Storage
-20C
Provider Type Product Number
- No reagents -