HPA023135

MRPL38 antibody from Atlas Antibodies
HSPC262, MGC4810, MRP-L3, RPML3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023135
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023135, RRID:AB_1854110
Product name
Anti-MRPL38
Provider product page
Atlas Antibodies - HPA023135
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FHGATFVPRVPLHVAYAVGEDDLMPVYCGNEVTPT
EAAQAPEVTYEAEEGSLWTLLLTSLDGHLLEPDAE
YLHWLLTNIPGNRVAE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -