HPA023054

MRPL38 antibody from Sigma-Aldrich
HSPC262, MGC4810, MRP-L3, RPML3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023054
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023054, RRID:AB_1854109
Product name
Anti-MRPL38 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023054
Antibody type
Polyclonal
Antigen
39S ribosomal protein L38, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EYFGEKTDPKEKIDIGLPPPKVSRTQQLLERKQAI
QELRANVEEERAARLRTASVPLDAVRAEWERTCGP
YHKQRL
Storage
-20C
Provider Type Product Number
- No reagents -