HPA023135

MRPL38 antibody from Sigma-Aldrich
HSPC262, MGC4810, MRP-L3, RPML3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023135
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023135, RRID:AB_1854110
Product name
Anti-MRPL38 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023135
Antibody type
Polyclonal
Antigen
39S ribosomal protein L38, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FHGATFVPRVPLHVAYAVGEDDLMPVYCGNEVTPT
EAAQAPEVTYEAEEGSLWTLLLTSLDGHLLEPDAE
YLHWLLTNIPGNRVAE
Storage
-20C
Provider Type Product Number
- No reagents -