HPA021195

ACOX1 antibody from Sigma-Aldrich
PALMCOX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021195
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021195, RRID:AB_1844528
Product name
Anti-ACOX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021195
Antibody type
Polyclonal
Antigen
Peroxisomal acyl-coenzyme A oxidase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AVRHQSEIKPGEPEPQILDFQTQQYKLFPLLATAY
AFQFVGAYMKETYHRINEGIGQGDLSELPELHALT
AGLKAFTSWTANTGIEACRMACGGHGY
Storage
-20C
Provider Type Product Number
- No reagents -