H00001264-M03A

CNN1 antibody from Abnova Corporation
Sm-Calp, SMCC
No application information provided.

Antibody data

Product number
H00001264-M03A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001264-M03A, RRID:AB_1136916
Product name
CNN1 monoclonal antibody (M03A), clone 3C7-2A6
Provider product page
Abnova Corporation - H00001264-M03A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CNN1.
Antigen sequence
MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELR
EWIEGVTGRRIGNNFMDGLKDGIILCEFINKLQPG
SVKKINESTQNWHQLENIGNFIKAITKYGVKPHDI
FEANDLFENTNHTQVQSTLLALASMAKTKGNKVNV
GVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFAS
QQGMTAYGTRRHLYDPKLGTDQPLDQATISLQMGT
NKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSL
QMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPE
LGEPAHNHHAHNYYNSA
Isotype
IgM
Antibody clone number
3C7-2A6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -