HPA026553

LRRC40 antibody from Sigma-Aldrich
FLJ20331
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026553
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026553, RRID:AB_1853312
Product name
Anti-LRRC40 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026553
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein 40 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PQGLLKAARKSGQLNLSGRNLSEVPQCVWRINVDI
PEEANQNLSFGATERWWEQTDLTKLIISNNKLQSL
TDDLRLLPALTVLDI
Storage
-20C
Provider Type Product Number
- No reagents -