HPA023303

SRP68 antibody from Atlas Antibodies
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023303
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023303, RRID:AB_1857477
Product name
Anti-SRP68
Provider product page
Atlas Antibodies - HPA023303
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DAKTKLEAQAYTAYLSGMLRFEHQEWKAAIEAFNK
CKTIYEKLASAFTEEQAVLYNQRVEEISPNIRYCA
YNIGDQSAINELMQMRLRSGGTEGLLAEKLEALIT
QTRAKQAATMSEVEWRGRTVPVKIDKVRIFLLGLA
DNEAAIV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -