HPA023303

SRP68 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023303
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023303, RRID:AB_1857477
Product name
Anti-SRP68 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023303
Antibody type
Polyclonal
Antigen
Signal recognition particle 68 kDa protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DAKTKLEAQAYTAYLSGMLRFEHQEWKAAIEAFNK
CKTIYEKLASAFTEEQAVLYNQRVEEISPNIRYCA
YNIGDQSAINELMQMRLRSGGTEGLLAEKLEALIT
QTRAKQAATMSEVEWRGRTVPVKIDKVRIFLLGLA
DNEAAIV
Storage
-20C
Provider Type Product Number
- No reagents -