H00023265-M01
antibody from Abnova Corporation
		Targeting: EXOC7
		
		BLOM4, EXO70, Exo70p, KIAA1067, YJL085W	
	
	
	
	
Antibody data
- Antibody Data
 - Antigen structure
 - References [0]
 - Comments [0]
 - Validations
 - Western blot [1]
 - ELISA [1]
 - Immunohistochemistry [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00023265-M01 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00023265-M01, RRID:AB_534861
 - Product name
 - EXOC7 monoclonal antibody (M01), clone 1D4
 - Antibody type
 - Monoclonal
 - Description
 - Mouse monoclonal antibody raised against a partial recombinant EXOC7.
 - Antigen sequence
 VFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQK
AWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSV
PFTKNPEKYIKYGVEQVGDMIDRLFDTSA- Isotype
 - IgG
 - Antibody clone number
 - 1D4
 - Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - EXOC7 monoclonal antibody (M01), clone 1D4 Western Blot analysis of EXOC7 expression in HeLa ( Cat # L013V1 ).
 
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Detection limit for recombinant GST tagged EXOC7 is approximately 1ng/ml as a capture antibody.
 - Validation comment
 - Sandwich ELISA (Recombinant protein)
 - Protocol
 - Protocol
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunoperoxidase of monoclonal antibody to EXOC7 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
 - Validation comment
 - Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
 - Protocol
 - Protocol