HPA022842

EXOC7 antibody from Sigma-Aldrich
EXO70, Exo70p, KIAA1067, YJL085W
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022842
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022842, RRID:AB_1848317
Product name
Anti-EXOC7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022842
Antibody type
Polyclonal
Antigen
Exocyst complex component 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DHVISYYHVASDTEKIIREGPTGRLEEYLGSMAKI
QKAVEYFQDNSPDSPELNKVKLLFERGKEALESEF
RSLMTRHSKVVSPVLILDLISGDDDLEAQEDVTLE
HLPESVLQDVIRISRW
Storage
-20C
Provider Type Product Number
- No reagents -