Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001491-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001491-M03, RRID:AB_489881
- Product name
- CTH monoclonal antibody (M03), clone S51
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant CTH.
- Antigen sequence
MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSR
AVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNC
LEKAVAALDGAKYCLAFASGLAATVTITHLLKAGD
QIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKI
KLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHI
VHKHGDIILVVDNTFMSPYFQRPLALGADISMYSA
TKYMNGRSDVVMGLVSVNCESLHNRLRFLQNSLGA
VPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFL
ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVT
FYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAEL
PAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEED
LLEDLDQALKAAHPPSGSHS- Isotype
- IgG
- Antibody clone number
- S51
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Hydrogen sulfide impairs glucose utilization and increases gluconeogenesis in hepatocytes.
cGMP-dependent protein kinase contributes to hydrogen sulfide-stimulated vasorelaxation.
An investigation of the mechanisms of hydrogen sulfide-induced vasorelaxation in rat middle cerebral arteries.
Characterization of hydrogen sulfide and its synthases, cystathionine β-synthase and cystathionine γ-lyase, in human prostatic tissue and cells.
Glucocorticoids suppress cystathionine gamma-lyase expression and H2S production in lipopolysaccharide-treated macrophages.
H2S contributes to the hepatic arterial buffer response and mediates vasorelaxation of the hepatic artery via activation of K(ATP) channels.
Zhang L, Yang G, Untereiner A, Ju Y, Wu L, Wang R
Endocrinology 2013 Jan;154(1):114-26
Endocrinology 2013 Jan;154(1):114-26
cGMP-dependent protein kinase contributes to hydrogen sulfide-stimulated vasorelaxation.
Bucci M, Papapetropoulos A, Vellecco V, Zhou Z, Zaid A, Giannogonas P, Cantalupo A, Dhayade S, Karalis KP, Wang R, Feil R, Cirino G
PloS one 2012;7(12):e53319
PloS one 2012;7(12):e53319
An investigation of the mechanisms of hydrogen sulfide-induced vasorelaxation in rat middle cerebral arteries.
Streeter E, Hart J, Badoer E
Naunyn-Schmiedeberg's archives of pharmacology 2012 Oct;385(10):991-1002
Naunyn-Schmiedeberg's archives of pharmacology 2012 Oct;385(10):991-1002
Characterization of hydrogen sulfide and its synthases, cystathionine β-synthase and cystathionine γ-lyase, in human prostatic tissue and cells.
Guo H, Gai JW, Wang Y, Jin HF, Du JB, Jin J
Urology 2012 Feb;79(2):483.e1-5
Urology 2012 Feb;79(2):483.e1-5
Glucocorticoids suppress cystathionine gamma-lyase expression and H2S production in lipopolysaccharide-treated macrophages.
Zhu XY, Liu SJ, Liu YJ, Wang S, Ni X
Cellular and molecular life sciences : CMLS 2010 Apr;67(7):1119-32
Cellular and molecular life sciences : CMLS 2010 Apr;67(7):1119-32
H2S contributes to the hepatic arterial buffer response and mediates vasorelaxation of the hepatic artery via activation of K(ATP) channels.
Siebert N, Cantré D, Eipel C, Vollmar B
American journal of physiology. Gastrointestinal and liver physiology 2008 Dec;295(6):G1266-73
American journal of physiology. Gastrointestinal and liver physiology 2008 Dec;295(6):G1266-73
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CTH monoclonal antibody (M03), clone S51 Western Blot analysis of CTH expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CTH expression in transfected 293T cell line by CTH monoclonal antibody (M03), clone S51.Lane 1: CTH transfected lysate(45 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CTH monoclonal antibody (M03), clone S51. Western Blot analysis of CTH expression in mouse kidney.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CTH is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to CTH on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol