Antibody data
- Antibody Data
- Antigen structure
- References [21]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001491-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001491-M01, RRID:AB_425388
- Product name
- CTH monoclonal antibody (M01), clone 4E1-1B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant CTH.
- Antigen sequence
MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSR
AVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNC
LEKAVAALDGAKYCLAFASGLAATVTITHLLKAGD
QIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKI
KLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHI
VHKHGDIILVVDNTFMSPYFQRPLALGADISMYSA
TKYMNGRSDVVMGLVSVNCESLHNRLRFLQNSLGA
VPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFL
ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVT
FYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAEL
PAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEED
LLEDLDQALKAAHPPSGSHS- Isotype
- IgG
- Antibody clone number
- 4E1-1B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Homocysteine Triggers Inflammatory Responses in Macrophages through Inhibiting CSE-H2S Signaling via DNA Hypermethylation of CSE Promoter.
Statins upregulate cystathionine γ-lyase transcription and H2S generation via activating Akt signaling in macrophage.
Reactive cysteine persulfides and S-polythiolation regulate oxidative stress and redox signaling.
Inhibition of hydrogen sulfide production by gene silencing attenuates inflammatory activity of LPS-activated RAW264.7 cells.
Hydrogen sulfide protects against cellular senescence via S-sulfhydration of Keap1 and activation of Nrf2.
Decreased endogenous production of hydrogen sulfide accelerates atherosclerosis.
Hydrogen sulfide and resolution of acute inflammation: A comparative study utilizing a novel fluorescent probe.
MicroRNA-21 represses human cystathionine gamma-lyase expression by targeting at specificity protein-1 in smooth muscle cells.
Is cystathionine gamma-lyase protein expressed in the heart?
Increased neointimal formation in cystathionine gamma-lyase deficient mice: role of hydrogen sulfide in α5β1-integrin and matrix metalloproteinase-2 expression in smooth muscle cells.
Hydrogen sulfide producing enzymes in pregnancy and preeclampsia.
Hydrogen sulfide modulates contractile function in rat jejunum.
Hydrogen sulfide inhibits the translational expression of hypoxia-inducible factor-1α.
Protective role of hydrogen sulfide against noise-induced cochlear damage: a chronic intracochlear infusion model.
Specificity protein-1 as a critical regulator of human cystathionine gamma-lyase in smooth muscle cells.
Hydrogen sulphide synthesis in the rat and mouse gastrointestinal tract.
Hydrogen sulfide from adipose tissue is a novel insulin resistance regulator.
Endogenous and exogenous hydrogen sulfide promotes resolution of colitis in rats.
Hydrogen sulfide protects rat lung from ischemia-reperfusion injury.
Hydrogen sulfide enhances ulcer healing in rats.
Hydrogen sulfide is a novel prosecretory neuromodulator in the Guinea-pig and human colon.
Li JJ, Li Q, Du HP, Wang YL, You SJ, Wang F, Xu XS, Cheng J, Cao YJ, Liu CF, Hu LF
International journal of molecular sciences 2015 Jun 3;16(6):12560-77
International journal of molecular sciences 2015 Jun 3;16(6):12560-77
Statins upregulate cystathionine γ-lyase transcription and H2S generation via activating Akt signaling in macrophage.
Xu Y, Du HP, Li J, Xu R, Wang YL, You SJ, Liu H, Wang F, Cao YJ, Liu CF, Hu LF
Pharmacological research 2014 Sep;87:18-25
Pharmacological research 2014 Sep;87:18-25
Reactive cysteine persulfides and S-polythiolation regulate oxidative stress and redox signaling.
Ida T, Sawa T, Ihara H, Tsuchiya Y, Watanabe Y, Kumagai Y, Suematsu M, Motohashi H, Fujii S, Matsunaga T, Yamamoto M, Ono K, Devarie-Baez NO, Xian M, Fukuto JM, Akaike T
Proceedings of the National Academy of Sciences of the United States of America 2014 May 27;111(21):7606-11
Proceedings of the National Academy of Sciences of the United States of America 2014 May 27;111(21):7606-11
Inhibition of hydrogen sulfide production by gene silencing attenuates inflammatory activity of LPS-activated RAW264.7 cells.
Badiei A, Rivers-Auty J, Ang AD, Bhatia M
Applied microbiology and biotechnology 2013 Sep;97(17):7845-52
Applied microbiology and biotechnology 2013 Sep;97(17):7845-52
Hydrogen sulfide protects against cellular senescence via S-sulfhydration of Keap1 and activation of Nrf2.
Yang G, Zhao K, Ju Y, Mani S, Cao Q, Puukila S, Khaper N, Wu L, Wang R
Antioxidants & redox signaling 2013 May 20;18(15):1906-19
Antioxidants & redox signaling 2013 May 20;18(15):1906-19
Decreased endogenous production of hydrogen sulfide accelerates atherosclerosis.
Mani S, Li H, Untereiner A, Wu L, Yang G, Austin RC, Dickhout JG, Lhoták Š, Meng QH, Wang R
Circulation 2013 Jun 25;127(25):2523-34
Circulation 2013 Jun 25;127(25):2523-34
Hydrogen sulfide and resolution of acute inflammation: A comparative study utilizing a novel fluorescent probe.
Dufton N, Natividad J, Verdu EF, Wallace JL
Scientific reports 2012;2:499
Scientific reports 2012;2:499
MicroRNA-21 represses human cystathionine gamma-lyase expression by targeting at specificity protein-1 in smooth muscle cells.
Yang G, Pei Y, Cao Q, Wang R
Journal of cellular physiology 2012 Sep;227(9):3192-200
Journal of cellular physiology 2012 Sep;227(9):3192-200
Is cystathionine gamma-lyase protein expressed in the heart?
Fu M, Zhang W, Yang G, Wang R
Biochemical and biophysical research communications 2012 Nov 30;428(4):469-74
Biochemical and biophysical research communications 2012 Nov 30;428(4):469-74
Increased neointimal formation in cystathionine gamma-lyase deficient mice: role of hydrogen sulfide in α5β1-integrin and matrix metalloproteinase-2 expression in smooth muscle cells.
Yang G, Li H, Tang G, Wu L, Zhao K, Cao Q, Xu C, Wang R
Journal of molecular and cellular cardiology 2012 Mar;52(3):677-88
Journal of molecular and cellular cardiology 2012 Mar;52(3):677-88
Hydrogen sulfide producing enzymes in pregnancy and preeclampsia.
Holwerda KM, Bos EM, Rajakumar A, Ris-Stalpers C, van Pampus MG, Timmer A, Erwich JJ, Faas MM, van Goor H, Lely AT
Placenta 2012 Jun;33(6):518-21
Placenta 2012 Jun;33(6):518-21
Hydrogen sulfide modulates contractile function in rat jejunum.
Kasparek MS, Linden DR, Farrugia G, Sarr MG
The Journal of surgical research 2012 Jun 15;175(2):234-42
The Journal of surgical research 2012 Jun 15;175(2):234-42
Hydrogen sulfide inhibits the translational expression of hypoxia-inducible factor-1α.
Wu B, Teng H, Yang G, Wu L, Wang R
British journal of pharmacology 2012 Dec;167(7):1492-505
British journal of pharmacology 2012 Dec;167(7):1492-505
Protective role of hydrogen sulfide against noise-induced cochlear damage: a chronic intracochlear infusion model.
Li X, Mao XB, Hei RY, Zhang ZB, Wen LT, Zhang PZ, Qiu JH, Qiao L
PloS one 2011;6(10):e26728
PloS one 2011;6(10):e26728
Specificity protein-1 as a critical regulator of human cystathionine gamma-lyase in smooth muscle cells.
Yang G, Pei Y, Teng H, Cao Q, Wang R
The Journal of biological chemistry 2011 Jul 29;286(30):26450-60
The Journal of biological chemistry 2011 Jul 29;286(30):26450-60
Hydrogen sulphide synthesis in the rat and mouse gastrointestinal tract.
Martin GR, McKnight GW, Dicay MS, Coffin CS, Ferraz JG, Wallace JL
Digestive and liver disease : official journal of the Italian Society of Gastroenterology and the Italian Association for the Study of the Liver 2010 Feb;42(2):103-9
Digestive and liver disease : official journal of the Italian Society of Gastroenterology and the Italian Association for the Study of the Liver 2010 Feb;42(2):103-9
Hydrogen sulfide from adipose tissue is a novel insulin resistance regulator.
Feng X, Chen Y, Zhao J, Tang C, Jiang Z, Geng B
Biochemical and biophysical research communications 2009 Feb 27;380(1):153-9
Biochemical and biophysical research communications 2009 Feb 27;380(1):153-9
Endogenous and exogenous hydrogen sulfide promotes resolution of colitis in rats.
Wallace JL, Vong L, McKnight W, Dicay M, Martin GR
Gastroenterology 2009 Aug;137(2):569-78, 578.e1
Gastroenterology 2009 Aug;137(2):569-78, 578.e1
Hydrogen sulfide protects rat lung from ischemia-reperfusion injury.
Fu Z, Liu X, Geng B, Fang L, Tang C
Life sciences 2008 Jun 6;82(23-24):1196-202
Life sciences 2008 Jun 6;82(23-24):1196-202
Hydrogen sulfide enhances ulcer healing in rats.
Wallace JL, Dicay M, McKnight W, Martin GR
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2007 Dec;21(14):4070-6
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2007 Dec;21(14):4070-6
Hydrogen sulfide is a novel prosecretory neuromodulator in the Guinea-pig and human colon.
Schicho R, Krueger D, Zeller F, Von Weyhern CW, Frieling T, Kimura H, Ishii I, De Giorgio R, Campi B, Schemann M
Gastroenterology 2006 Nov;131(5):1542-52
Gastroenterology 2006 Nov;131(5):1542-52
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CTH expression in transfected 293T cell line by CTH monoclonal antibody (M01), clone 4E1-1B7.Lane 1: CTH transfected lysate (Predicted MW: 44.5 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CTH monoclonal antibody (M01), clone 4E1-1B7. Western Blot analysis of CTH expression in human liver.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CTH is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol