Antibody data

Product number
H00001491-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001491-M01A, RRID:AB_1574152
Product name
CTH monoclonal antibody (M01A), clone 4E1-1B7
Provider product page
Abnova Corporation - H00001491-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CTH.
Antigen sequence
MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSR
AVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNC
LEKAVAALDGAKYCLAFASGLAATVTITHLLKAGD
QIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKI
KLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHI
VHKHGDIILVVDNTFMSPYFQRPLALGADISMYSA
TKYMNGRSDVVMGLVSVNCESLHNRLRFLQNSLGA
VPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFL
ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVT
FYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAEL
PAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEED
LLEDLDQALKAAHPPSGSHS
Isotype
IgG
Antibody clone number
4E1-1B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -