HPA021591

CTH antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021591
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021591, RRID:AB_1847321
Product name
Anti-CTH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021591
Antibody type
Polyclonal
Antigen
Cystathionine gamma-lyase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVD
CSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEG
CAHIVHKHGDIILVVDNTFMSPYFQRPLALGAD
Storage
-20C
Provider Type Product Number
- No reagents -