Antibody data

Product number
H00009465-M13
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009465-M13, RRID:AB_1137087
Product name
AKAP7 monoclonal antibody (M13), clone 1F9
Provider product page
Abnova Corporation - H00009465-M13
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant AKAP7.
Antigen sequence
SEEFEANTMDSLVDMPFATVDIQDDCGITDEPQIN
LKRSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPI
TNKEIIKGIKILQNAIIQQDERLAKAMVSDGSFHI
TLLVMQLLN
Isotype
IgG
Antibody clone number
1F9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -