HPA024318

ZSCAN18 antibody from Sigma-Aldrich
FLJ12895, ZNF447
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024318
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024318, RRID:AB_1859494
Product name
Anti-ZSCAN18 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024318
Antibody type
Polyclonal
Antigen
Zinc finger and SCAN domain-containing protein 18 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QFLGILPDKVRPWVVAQYPESCKKAASLVEGLADV
LEEPGMLLGSPAGSSSILSDGVYERHMDPLLLPGE
LASPSQALGAGEIPAPSETPWLSPDPLFLEQRRVR
EAKTEEDGPANTEQKL
Storage
-20C
Provider Type Product Number
- No reagents -