PAB21465

QRICH2 antibody from Abnova Corporation
DKFZP434P0316

Antibody data

Product number
PAB21465
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21465, RRID:AB_10967989
Product name
QRICH2 polyclonal antibody
Provider product page
Abnova Corporation - PAB21465
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant QRICH2.
Antigen sequence
LPGHHSIRPYTVFELEQVRQHSRNLKLGSAFPRGD
LAQMEQSVGRLRSMHSKMLMNIEKVQIHFGGSTKA
SSQIIRELLHAQCLGSPCYKRVTDMADYTYSTVPR
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -