HPA021935

QRICH2 antibody from Sigma-Aldrich
DKFZP434P0316
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021935
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021935, RRID:AB_2173307
Product name
Anti-QRICH2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021935
Antibody type
Polyclonal
Antigen
Glutamine-rich protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPGHHSIRPYTVFELEQVRQHSRNLKLGSAFPRGD
LAQMEQSVGRLRSMHSKMLMNIEKVQIHFGGSTKA
SSQIIRELLHAQCLGSPCYKRVTDMADYTYSTVPR
Storage
-20C
Provider Type Product Number
- No reagents -