HPA022829

SPHK1 antibody from Sigma-Aldrich
SPHK
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022829
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022829, RRID:AB_1857438
Product name
Anti-SPHK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022829
Antibody type
Polyclonal
Antigen
Sphingosine kinase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPAS
PVVVQQGPVDAHLVPLEEPVPSHWTVVPDEDFVLV
LALLHSHLGSEMFAAPMGRCAAGVMHLFYV
Storage
-20C
Provider Type Product Number
- No reagents -