HPA012577

ATG16L1 antibody from Sigma-Aldrich
APG16L, ATG16A, ATG16L, FLJ10035, WDR30
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012577
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012577, RRID:AB_1845155
Product name
Anti-ATG16L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012577
Antibody type
Polyclonal
Antigen
Autophagy-related protein 16-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRR
VKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSY
LLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAK
FLLDNARIVSGSHDRTLKLWDLRSKV
Storage
-20C
Provider Type Product Number
- No reagents -