Explore
Validate
LearnHPA018080
antibody from Atlas Antibodies
Targeting: RHBDF2
FLJ22341, iRhom2, RHBDL5, RHBDL6, TOC, TOCG
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA018080 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-RHBDF2
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RKPPNLSITIPPPEKETQAPGEQDSMLPERKNPAY
LKSVSLQEPRSRWQGSSEKRPGFRRQASLSQSIRK
GAAQWFGVSGDWEGQRQQWQRRSLHHCSMRYGRLK
ASCQRDL- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references iRhom2 in the pathogenesis of oral squamous cell carcinoma
RHBDF2 Mutations Are Associated with Tylosis, a Familial Esophageal Cancer Syndrome
Agwae M, Shaw R, Triantafyllou A, Greaney F, Ben Salah K, Risk J
Molecular Biology Reports 2020;47(5):3987-3992
Molecular Biology Reports 2020;47(5):3987-3992
RHBDF2 Mutations Are Associated with Tylosis, a Familial Esophageal Cancer Syndrome
Blaydon D, Etheridge S, Risk J, Hennies H, Gay L, Carroll R, Plagnol V, McRonald F, Stevens H, Spurr N, Bishop D, Ellis A, Jankowski J, Field J, Leigh I, South A, Kelsell D
The American Journal of Human Genetics 2012;90(2):340-346
The American Journal of Human Genetics 2012;90(2):340-346
No comments: Submit comment
No validations: Submit validation data