ABIN501799

ZNF446 antibody from antibodies-online
FLJ20626, ZKSCAN20, ZSCAN52

Antibody data

Product number
ABIN501799
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 446 (ZNF446) (N-Term) antibody
Provider product page
antibodies-online - ABIN501799
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF446 antibody: synthetic peptide directed towards the N terminal of human ZNF446
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
MPSPLGPPCLPVMDPETTLEEPETARLRFRGFCYQ
EVAGP REALARLREL
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -