AV39319

ZNF446 antibody from MilliporeSigma / Merck KGaA
FLJ20626, ZKSCAN20, ZSCAN52
No application information provided.

Antibody data

Product number
AV39319
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV39319, RRID:AB_1859274
Product name
Anti-ZNF446 (AB2) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV39319
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF446 with an internal ID of P21331
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
PCEECGCSFSWKSQLVIHRKSHTGQRRHFCSDCGR
AFDWKSQLVIHRKGH
Storage
-20C
Provider Type Product Number
- No reagents -