HPA023290

CRYZ antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023290
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023290, RRID:AB_1847263
Product name
Anti-CRYZ antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023290
Antibody type
Polyclonal
Antigen
Quinone oxidoreductase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLI
KVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAG
VIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAA
DHTVYKLPE
Storage
-20C
Provider Type Product Number
- No reagents -