HPA007649

MAP1LC3A antibody from Atlas Antibodies
ATG8E, LC3, LC3A, MAP1ALC3, MAP1BLC3

Antibody data

Product number
HPA007649
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007649, RRID:AB_1853943
Product name
Anti-MAP1LC3A
Provider product page
Atlas Antibodies - HPA007649
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVII
ERYKGEKQLPVLDKTKFLVPDHVNMS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.