HPA007649

MAP1LC3A antibody from Sigma-Aldrich
ATG8E, LC3, LC3A, MAP1ALC3, MAP1BLC3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007649
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007649, RRID:AB_1853943
Product name
Anti-MAP1LC3A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007649
Antibody type
Polyclonal
Antigen
Microtubule-associated proteins 1A/1B light chain 3A precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVII
ERYKGEKQLPVLDKTKFLVPDHVNMS
Storage
-20C
Provider Type Product Number
- No reagents -