H00006427-B01

SRSF2 antibody from Abnova Corporation
PR264, SC-35, SC35, SFRS2, SFRS2A

Antibody data

Product number
H00006427-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006427-B01, RRID:AB_913927
Product name
SFRS2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00006427-B01
Antibody type
Polyclonal
Antigen
SFRS2 (AAH66958, 1 a.a. ~ 179 a.a) full-length human protein.
Reactivity
Human
Host
Mouse
Antigen sequence
MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFE
KYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAED
AMDAMDGADPGVGAVPGLAADLATAARSLGPALVL
DLGRPPSPDPHEGPSPSPRRSPDLVRGPGPGLGPG
VLPQCPRGNPNPGRDRRVPPSLLKRKERCPLKKML
RSPV
Vial size
50 uL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -