HPA007049

ATG4C antibody from Sigma-Aldrich
APG4C, AUTL1, AUTL3, FLJ14867
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007049
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007049, RRID:AB_1845159
Product name
Anti-ATG4C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007049
Antibody type
Polyclonal
Antigen
Cysteine protease ATG4C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMT
SDNADDKAVIILVPVRLGGERTNTDYLEFVKGILS
LEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQ
SFV
Storage
-20C
Provider Type Product Number
- No reagents -