HPA022001

MFSD11 antibody from Atlas Antibodies
FLJ20226, FLJ22196
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA022001
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA022001, RRID:AB_2297599
Product name
Anti-MFSD11
Provider product page
Atlas Antibodies - HPA022001
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DSENVLGEDESSDDQDMEVNESAQNNLTKAVDAFK
KSFKLCVTKEML
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -