HPA022001

MFSD11 antibody from Sigma-Aldrich
FLJ20226, FLJ22196
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022001
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022001, RRID:AB_2297599
Product name
Anti-MFSD11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022001
Antibody type
Polyclonal
Antigen
UNC93-like protein MFSD11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSENVLGEDESSDDQDMEVNESAQNNLTKAVDAFK
KSFKLCVTKEML
Storage
-20C
Provider Type Product Number
- No reagents -