HPA026585

RABGGTB antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026585
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026585, RRID:AB_1856026
Product name
Anti-RABGGTB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026585
Antibody type
Polyclonal
Antigen
Geranylgeranyl transferase type-2 subunit beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REKLRNFILACQDEETGGFADRPGDMVDPFHTLFG
IAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPEL
VS
Storage
-20C
Provider Type Product Number
- No reagents -