HPA007639

ATG7 antibody from Atlas Antibodies
APG7L, DKFZp434N0735, GSA7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007639
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007639, RRID:AB_1233517
Product name
Anti-ATG7
Provider product page
Atlas Antibodies - HPA007639
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPT
PARCCPAIGTLYNTNTLESFKTADKKLLLEQAANE
IWESIKSGTALENPVLLNKFLLLTFADLKKYHFYY
WFCYPALCLPESLPLIQGPVGLDQRFSLKQIEAL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -