HPA007639

ATG7 antibody from Sigma-Aldrich
APG7L, DKFZp434N0735, GSA7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007639
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007639, RRID:AB_1845162
Product name
Anti-ATG7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007639
Antibody type
Polyclonal
Antigen
Autophagy-related protein 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPT
PARCCPAIGTLYNTNTLESFKTADKKLLLEQAANE
IWESIKSGTALENPVLLNKFLLLTFADLKKYHFYY
WFCYPALCLPESLPLIQGPVGLDQRFSLKQIEAL
Storage
-20C
Provider Type Product Number
- No reagents -