HPA019128

AK5 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019128
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019128, RRID:AB_1844682
Product name
Anti-AK5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019128
Antibody type
Polyclonal
Antigen
Adenylate kinase isoenzyme 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLFPNKEAAAGSSDLDPSMILDTGEIIDTGSDYED
QGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGS
GKGTQCEKLVE
Storage
-20C
Provider Type Product Number
- No reagents -