Antibody data

Product number
PAB21931
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21931, RRID:AB_10963865
Product name
TCF21 polyclonal antibody
Provider product page
Abnova Corporation - PAB21931
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant TCF21.
Antigen sequence
LSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEE
SSNCENGSPQKGRGGLGKRRKAPTKKSPLSGVSQE
GKQV
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -