HPA013189

TCF21 antibody from Sigma-Aldrich
bHLHa23, POD1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013189
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013189, RRID:AB_10601215
Product name
Anti-TCF21 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013189
Antibody type
Polyclonal
Antigen
transcription factor 21 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSDVEDLQEVEMLECDGLKMDSNKEFVTSNESTEE
SSNCENGSPQKGRGGLGKRRKAPTKKSPLSGVSQE
GKQV
Storage
-20C
Provider Type Product Number
- No reagents -