HPA009426

DPEP1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009426
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009426, RRID:AB_1847842
Product name
Anti-DPEP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009426
Antibody type
Polyclonal
Antigen
Dipeptidase 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VMVNFYNNYISCTNKANLSQVADHLDHIKEVAGAR
AVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRN
WTEAEVKGALADNLLRVFQAVEQASNLTQAPEEEP
IPLDQLGGSCRTHYGYSSGAS
Storage
-20C
Provider Type Product Number
- No reagents -