HPA023861

AFMID antibody from Atlas Antibodies
DKFZp686F03259, KF
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023861
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023861, RRID:AB_1844636
Product name
Anti-AFMID
Provider product page
Atlas Antibodies - HPA023861
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGA
EEALRTYSQIGIEATTRARATRKSLLHVPYGD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -