PAB21805

AFMID antibody from Abnova Corporation
DKFZp686F03259, KF

Antibody data

Product number
PAB21805
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21805, RRID:AB_10983859
Product name
AFMID polyclonal antibody
Provider product page
Abnova Corporation - PAB21805
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant AFMID.
Antigen sequence
LPFFLFFHGGYWQSGSKDESAFMVHPLTAQGVAVV
IVAYGIAPKGTLDHMVDQVTRSVAFVQKRY
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.