HPA026536

AFMID antibody from Sigma-Aldrich
DKFZp686F03259, KF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026536
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026536, RRID:AB_1844637
Product name
Anti-AFMID antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026536
Antibody type
Polyclonal
Antigen
Probable arylformamidase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LPFFLFFHGGYWQSGSKDESAFMVHPLTAQGVAVV
IVAYGIAPKGTLDHMVDQVTRSVAFVQKRY
Storage
-20C
Provider Type Product Number
- No reagents -