HPA024354

DNAH17 antibody from Atlas Antibodies
DNAHL1, DNEL2, FLJ40457
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024354
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024354, RRID:AB_1847911
Product name
Anti-DNAH17
Provider product page
Atlas Antibodies - HPA024354
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VFQYIQEVREILHNLQNRMQKAKQNIEGISQAMKD
WSANPLFERKDNKKEALLDLDGRIANLNKRYAAVR
DAGVKIQAMVAVRKHPG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -