HPA012753

CYP2W1 antibody from Sigma-Aldrich
FLJ20359, MGC34287
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012753
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012753, RRID:AB_1847444
Product name
Anti-CYP2W1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012753
Antibody type
Polyclonal
Antigen
Cytochrome P450 2W1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLTGFEAVKEALAGPGQELADRPPIAIFQLIQRGG
GIFFSSGARWRAARQFTVRALHSLGVGREPVADKI
LQELKCLSGQLDGYRGRPFPLALLGWAPSNITFAL
LFGRRFDYRDPVFVSLLG
Storage
-20C
Provider Type Product Number
- No reagents -