HPA012753

CYP2W1 antibody from Atlas Antibodies
FLJ20359, MGC34287
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012753
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012753, RRID:AB_1847444
Product name
Anti-CYP2W1
Provider product page
Atlas Antibodies - HPA012753
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VLTGFEAVKEALAGPGQELADRPPIAIFQLIQRGG
GIFFSSGARWRAARQFTVRALHSLGVGREPVADKI
LQELKCLSGQLDGYRGRPFPLALLGWAPSNITFAL
LFGRRFDYRDPVFVSLLG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -