HPA027148

IFI44 antibody from Sigma-Aldrich
MTAP44, p44, TLDC5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027148
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027148, RRID:AB_1851411
Product name
Anti-IFI44 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027148
Antibody type
Polyclonal
Antigen
Interferon-induced protein 44 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQD
YEVFRCEDSLDERKIKGVIELRKSLLSALRTYEPY
GSLVQQIRILLLGP
Storage
-20C
Provider Type Product Number
- No reagents -